Rabbit anti-GJA4 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GJA4 |
Rabbit anti-GJA4 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GJA4 |
Rabbit Polyclonal Anti-GJA4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GJA4 antibody: synthetic peptide directed towards the middle region of human GJA4. Synthetic peptide located within the following region: QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA |
Rabbit polyclonal anti-GJA4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from nal of human GJA4. |