Rabbit Polyclonal Anti-KLHL25 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: RLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFE |
Rabbit Polyclonal Anti-KLHL25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KLHL25 Antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: SRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENA |
Rabbit Polyclonal Anti-KLHL25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: LFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTL |
Germany
Japan
United Kingdom
China
