Antibodies

Jump to Filters
View as table Download
NCF4 Rabbit Polyclonal Antibody
TA323606

USD 345.00

4 Weeks

Anti-NCF4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 190 amino acids of human neutrophil cytosolic factor 4, 40kDa
NCF4 Goat Polyclonal Antibody
TA302546

USD 375.00

5 Days

Goat Polyclonal Antibody against NCF4 / P40PHOX

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KDFPEEDDPTN, from the internal region of the protein sequence according to NP_000622.2; NP_038202.1.
NCF4 Rabbit Polyclonal Antibody
TA338965

USD 375.00

5 Days

Rabbit Polyclonal Anti-NCF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCF4 antibody: synthetic peptide directed towards the N terminal of human NCF4. Synthetic peptide located within the following region: SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE
NCF4 Rabbit Polyclonal Antibody
TA338966

USD 375.00

5 Days

Rabbit Polyclonal Anti-NCF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCF4 antibody: synthetic peptide directed towards the middle region of human NCF4. Synthetic peptide located within the following region: TGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAF
NCF4 Rabbit Polyclonal Antibody
TA378955

USD 300.00

3 Weeks

Phospho-NCF4/p40-phox-T154 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around T154 of human NCF4.
Modifications Unmodified