Antibodies

Jump to Filters
View as table Download
NELL2 Rabbit Polyclonal Antibody
TA339034

USD 310.00

5 Days

Rabbit Polyclonal Anti-NELL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NELL2 antibody: synthetic peptide directed towards the N terminal of human NELL2. Synthetic peptide located within the following region: MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG
NELL2 Rabbit Polyclonal Antibody
TA379056

USD 220.00

3 Weeks

NELL2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NELL2.
Modifications Unmodified