Rabbit Polyclonal Anti-Pygm Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pygm antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKI |
PYGM rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PYGM |
PYGM Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 700 to the C-terminus of human PYGM (NP_005600.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
