Antibodies

View as table Download

Rabbit polyclonal anti-RAD54 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD54.

Rabbit Polyclonal Anti-RAD54L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD54L antibody: synthetic peptide directed towards the N terminal of human RAD54L. Synthetic peptide located within the following region: VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGAR

RAD54L Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RAD54L.
Modifications Unmodified