Rabbit polyclonal anti-RFX2 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RFX2. |
Rabbit polyclonal anti-RFX2 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RFX2. |
Rabbit Polyclonal Anti-RFX2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFX2 antibody: synthetic peptide directed towards the middle region of human RFX2. Synthetic peptide located within the following region: NDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQG |
RFX2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 295-450 of human RFX2 (NP_000626.2). |
Modifications | Unmodified |