Antibodies

View as table Download

Rabbit polyclonal anti-SYT11 antibody

Applications WB
Reactivities Human, Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SYT11.

Rabbit Polyclonal Anti-SYT11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYT11 antibody: synthetic peptide directed towards the N terminal of human SYT11. Synthetic peptide located within the following region: AGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPS

Rabbit Polyclonal Anti-SYT11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYT11 antibody: synthetic peptide directed towards the N terminal of human SYT11. Synthetic peptide located within the following region: PPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAE

Anti-SYT11 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 37-200 amino acids of human synaptotagmin XI

Anti-SYT11 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 37-200 amino acids of human synaptotagmin XI

SYT11 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 37-200 of human SYT11 (NP_689493.3).
Modifications Unmodified