Antibodies

View as table Download

Goat Polyclonal Antibody against SMUG1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PQAFLLGSIHEPA-C, from the N Terminus of the protein sequence according to NP_055126.

Rabbit polyclonal anti-SMUG1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SMUG1.

Rabbit Polyclonal Anti-SMUG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMUG1 antibody: synthetic peptide directed towards the middle region of human SMUG1. Synthetic peptide located within the following region: IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC

Rabbit polyclonal anti-SMUG1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SMUG1

Rabbit polyclonal anti-SMUG1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SMUG1