Rabbit polyclonal anti-ACVL1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ACVL1. |
Rabbit polyclonal anti-ACVL1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ACVL1. |
ACVRL1 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Immunogen | Peptide with sequence C-KISNSPEKPKVIQ, from the C Terminus of the protein sequence according to NP_000011.2; NP_001070869.1. |
Rabbit Polyclonal Anti-ACVRL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACVRL1 antibody: synthetic peptide directed towards the N terminal of human ACVRL1. Synthetic peptide located within the following region: SPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNH |