Antibodies

View as table Download

Rabbit polyclonal antibody to FMO2 (flavin containing monooxygenase 2 (non-functional))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 74 and 354 of FMO2 (Uniprot ID#Q99518)

Rabbit Polyclonal Anti-FMO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FMO2 antibody: synthetic peptide directed towards the N terminal of human FMO2. Synthetic peptide located within the following region: KYIQFQTTVLSVRKCPDFSSSGQWKVVTQSNGKEQSAVFDAVMVCSGHHI