Goat Polyclonal Antibody against NRG3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RNEIQRDSALTK, from the C Terminus of the protein sequence according to NP_001010848.2. |
Goat Polyclonal Antibody against NRG3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RNEIQRDSALTK, from the C Terminus of the protein sequence according to NP_001010848.2. |
Rabbit Polyclonal Anti-NRG3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NRG3 Antibody: synthetic peptide directed towards the middle region of human NRG3. Synthetic peptide located within the following region: TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM |
Rabbit Polyclonal Anti-NRG3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NRG3 |