Bile salt activated lipase (CEL) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 453-482 amino acids from the Central region of human CEL |
Bile salt activated lipase (CEL) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 453-482 amino acids from the Central region of human CEL |
Rabbit Polyclonal Anti-CEL Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-CEL antibody: synthetic peptide directed towards the middle region of human CEL. Synthetic peptide located within the following region: VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR |
Rabbit Polyclonal Anti-CEL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CEL |