Rabbit Polyclonal Patched 2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | residues 226-235 [GPFASLEGFR] of the human PTCH2 protein |
Rabbit Polyclonal Patched 2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | residues 226-235 [GPFASLEGFR] of the human PTCH2 protein |
Rabbit Polyclonal Anti-PTCH2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTCH2 antibody: synthetic peptide directed towards the N terminal of human PTCH2. Synthetic peptide located within the following region: LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV |