Antibodies

View as table Download

Rabbit Polyclonal Anti-PIP5K1A Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pip5k1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a. Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS

Rabbit Polyclonal Anti-PIP5K1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PIP5K1A