Rabbit Polyclonal TRIP6 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRIP6 antibody was raised against a 15 amino acid synthetic peptide near the center of human TRIP6. |
Rabbit Polyclonal TRIP6 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRIP6 antibody was raised against a 15 amino acid synthetic peptide near the center of human TRIP6. |
Goat Anti-TRIP6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SHGVLQHTQGLP, from the internal region of the protein sequence according to NP_003293.2. |
Rabbit Polyclonal Anti-TRIP6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRIP6 antibody: synthetic peptide directed towards the N terminal of human TRIP6. Synthetic peptide located within the following region: MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLP |
Rabbit Polyclonal Anti-TRIP6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRIP6 antibody: synthetic peptide directed towards the middle region of human TRIP6. Synthetic peptide located within the following region: ASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVW |
Rabbit Polyclonal Anti-TRIP6 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TRIP6 |