Antibodies

Jump to Filters
View as table Download
XPD (ERCC2) Rabbit Polyclonal Antibody
TA590019

USD 409.00

In Stock

Rabbit Polyclonal XPD Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
XPD (ERCC2) Rabbit Polyclonal Antibody
TA330046

USD 375.00

5 Days

Rabbit Polyclonal Anti-ERCC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC2 antibody: synthetic peptide directed towards the N terminal of human ERCC2. Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS