Antibodies

View as table Download

OR2F2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 294-317 amino acids from the C-terminal region of Human Olfactory receptor 2F2

Rabbit polyclonal anti-OR2F2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2F2.

Rabbit Polyclonal Anti-OR2F2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2F2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2F2. Synthetic peptide located within the following region: PHSGPSVLQEKLISVFYAIVMPLLNPVIYSLRNKEVKGAWHKLLEKFSGL