Rabbit Polyclonal Anti-PDE7A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE7A antibody is: synthetic peptide directed towards the C-terminal region of Human PDE7A. Synthetic peptide located within the following region: DRGDLCLEDTRHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQ |
Phosphodiesterase 7a / PDE7A Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Xenopus, Gorilla, Human, Monkey, Orang-Utan, Rabbit |
| Immunogen | PDE7A antibody was raised against synthetic 17 amino acid peptide from N-terminus of human PDE7A. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Elephant, Panda, Rabbit, Opossum, Xenopus (100%); Mouse, Rat, Hamster, Turkey, Lizard (94%); Zebrafish (82%). |
PDE7A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China