Antibodies

Jump to Filters
View as table Download
OR10S1 Rabbit Polyclonal Antibody
TA316237

USD 345.00

In Stock

Rabbit polyclonal anti-OR10S1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10S1.
OR10S1 (C-term) Rabbit Polyclonal Antibody
AP53012PU-N

USD 450.00

2 Weeks

OR10S1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 225-254 amino acids from the C-terminal region of Human Olfactory receptor 10S1
OR10S1 Rabbit Polyclonal Antibody
TA332319

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR10S1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10S1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10S1. Synthetic peptide located within the following region: RIRTAQGRQRAFSPCTAQLTGVLLYYVPPVCIYLQPRSSEAGAGAPAVFY