Antibodies

View as table Download

Rabbit polyclonal anti-OR8D1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR8D1.

Rabbit Polyclonal Anti-OR8D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR8D1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR8D1. Synthetic peptide located within the following region: SKAFGTCSSHLMAVVIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPM

Rabbit Polyclonal Anti-OR8D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR8D1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR8D1. Synthetic peptide located within the following region: FFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA