Antibodies

Jump to Filters
View as table Download
TRIB2 Goat Polyclonal Antibody
AP22971PU-N

USD 440.00

2 Weeks

TRIB2 goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bat, Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus
Immunogen Synthetic peptide from human TRIB2
TRIB2 Rabbit Polyclonal Antibody
TA333723

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRIB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIB2 Antibody: synthetic peptide directed towards the middle region of human TRIB2. Synthetic peptide located within the following region: YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE
TRIB2 Rabbit Polyclonal Antibody
TA350539

USD 345.00

In Stock

Rabbit Polyclonal Anti-TRIB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
TRIB2 Rabbit Polyclonal Antibody
TA365102

USD 380.00

4 Weeks

TRIB2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
TRIB2 Rabbit Polyclonal Antibody
TA382801

USD 220.00

3 Weeks

TRIB2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human TRIB2 (NP_067675.1).
Modifications Unmodified