Rabbit polyclonal anti-ARMX3 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ARMX3. |
Rabbit polyclonal anti-ARMX3 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ARMX3. |
Rabbit Polyclonal Anti-ARMX3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARMX3 Antibody: A synthesized peptide derived from human ARMX3 |
Rabbit Polyclonal Anti-ARMCX3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARMCX3 antibody: synthetic peptide directed towards the middle region of human ARMCX3. Synthetic peptide located within the following region: LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE |
Rabbit Polyclonal Anti-ARMCX3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARMCX3 |
ARMCX3 rabbit polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARMCX3 |
ARMCX3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-140 of human ARMCX3 (NP_057691.1). |
Modifications | Unmodified |