Rabbit Polyclonal Anti-BBS4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BBS4 antibody: synthetic peptide directed towards the N terminal of human BBS4. Synthetic peptide located within the following region: YVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAA |
Rabbit Polyclonal Anti-BBS4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BBS4 antibody: synthetic peptide directed towards the middle region of human BBS4. Synthetic peptide located within the following region: LGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVAC |
Goat Anti-BBS4 (aa 125-139) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NEAAKLNQKDWEISH, from the Internal Region of the protein sequence according to NP_149017.2. |
BBS4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human BBS4 |
Germany
Japan
United Kingdom
China
