Antibodies

View as table Download

Rabbit Polyclonal APC8 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC8 antibody was raised against a 17 amino acid synthetic peptide near the center of human APC8.

Rabbit polyclonal anti-APC8 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human APC8.

Rabbit Polyclonal Anti-IRF6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IRF6 Antibody: synthetic peptide directed towards the C terminal of human IRF6. Synthetic peptide located within the following region: FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR

Rabbit Polyclonal Anti-CDC23 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDC23

CDC23 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CDC23

CDC23 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CDC23

CDC23 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CDC23

CDC23 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CDC23

CDC23 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDC23

CDC23 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CDC23 (NP_004652.2).
Modifications Unmodified