Rabbit Polyclonal Anti-CTRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTRB1 antibody: synthetic peptide directed towards the middle region of human CTRB1. Synthetic peptide located within the following region: VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND |
Rabbit Polyclonal Anti-CTRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTRB1 antibody: synthetic peptide directed towards the N terminal of human CTRB1. Synthetic peptide located within the following region: MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVS |
Rabbit Polyclonal Anti-CTRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTRB1 antibody: synthetic peptide directed towards the middle region of human CTRB1. Synthetic peptide located within the following region: FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT |
CTRB1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CTRB1 |
CTRB1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 79-263 of human CTRB1 (NP_001897.4). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
