Antibodies

View as table Download

Rabbit Polyclonal Anti-DMRT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DMRT3 Antibody: synthetic peptide directed towards the middle region of human DMRT3. Synthetic peptide located within the following region: ALQAQLAKPDLTEERLGDGKSADNTEVFSDKDTDQRSSPDVAKSKGCFTP

Rabbit Polyclonal Anti-DMRT3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DMRT3

DMRT3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DMRT3