Antibodies

View as table Download

Goat Polyclonal Antibody against ELMO1

Applications WB
Reactivities Human, Cow, ZebraFish
Conjugation Unconjugated
Immunogen Peptide with sequence PKEPSNYDFVYDCN, from the C Terminus of the protein sequence according to NP_055615.8; NP_569709.1; NP_001034548.1.

Rabbit Polyclonal Anti-ELMO1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELMO1 antibody: synthetic peptide directed towards the C terminal of human ELMO1. Synthetic peptide located within the following region: TQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIELT

ELMO1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ELMO1

ELMO1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ELMO1

ELMO1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ELMO1

ELMO1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 527-727 of human ELMO1 (NP_055615.8).
Modifications Unmodified