Rabbit Polyclonal Anti-ESRRG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN |
Goat Polyclonal Antibody against ESRRG
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CRMSNKDRHIDS, from the internal region of the protein sequence according to NP_001429.2; NP_996317.1; NP_996318.1. |
Rabbit polyclonal ESRRG Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ESRRG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 189-221 amino acids from the Central region of human ESRRG. |
Rabbit Polyclonal Anti-ESRRG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML |
Rabbit Polyclonal Anti-ESRRG Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ESRRG / ERR Gamma antibody was raised against synthetic 15 amino acid peptide from C-terminus of human ESRRG / ERR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Lizard (100%); Bat, Xenopus, Zebrafish (93%); Stickleback, Medaka, Pufferfish (87%). |
Rabbit Polyclonal Anti-ESRRG Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ESRRG / ERR Gamma antibody was raised against synthetic 14 amino acid peptide from N-terminus of human ESRRG / ERR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit (100%); Opossum, Turkey, Chicken, Platypus, Lizard, Xenopus (93%); Zebrafish (86%). |
ESRRG Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ESRRG (NP_001429.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
