Rabbit Polyclonal Anti-EXOC4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EXOC4 Antibody: synthetic peptide directed towards the N terminal of human EXOC4. Synthetic peptide located within the following region: MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA |
Rabbit Polyclonal Anti-EXOC4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EXOC4 Antibody: synthetic peptide directed towards the N terminal of human EXOC4. Synthetic peptide located within the following region: TAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIE |
EXOC4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human EXOC4 (NP_068579.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China