Rabbit Polyclonal Anti-Fra 2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Fra 2 Antibody: A synthesized peptide derived from human Fra 2 |
Rabbit Polyclonal Anti-Fra 2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Fra 2 Antibody: A synthesized peptide derived from human Fra 2 |
Rabbit polyclonal anti-Fra-2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Fra-2. |
Rabbit polyclonal FOSL2 Antibody (C-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FOSL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 220-248 amino acids from the C-terminal region of human FOSL2. |
Rabbit Polyclonal anti-FOSL2 antibody
Applications | IHC, WB |
Reactivities | Human, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2. Synthetic peptide located within the following region: PMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY |
Rabbit Polyclonal anti-FOSL2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2. Synthetic peptide located within the following region: KLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRS |
FOSL2 rabbit polyclonal antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FOSL2 |