Antibodies

View as table Download

Rabbit Polyclonal Anti-GDI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GDI2 antibody: synthetic peptide directed towards the C terminal of human GDI2. Synthetic peptide located within the following region: EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHF

GDI2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GDI2

GDI2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GDI2

GDI2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 296-445 of human GDI2 (NP_001485.2).
Modifications Unmodified