Germany
Japan
United Kingdom
China
Rabbit anti-GRN Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRN |
Antibodies
View as table Download
Goat Anti-Granulin / GRN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence QSKCLSKENATTD, from the internal region of the protein sequence according to NP_002078.1. |
Rabbit polyclonal GRN Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GRN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 563-591 amino acids from the C-terminal region of human GRN. |
Rabbit Polyclonal Anti-GRN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRN antibody is: synthetic peptide directed towards the middle region of Human GRN. Synthetic peptide located within the following region: CPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD |
GRN rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GRN |
Granulin Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 281-336 of human Granulin (NP_002078.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GRN
Reactivities
- Human
Clonalities
- Polyclonal