Antibodies

Jump to Filters
View as table Download
KLHL25 Chicken Polyclonal Antibody
TA306963

USD 430.00

5 Days

Chicken Polyclonal ENC-2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ENC-2 antibody was raised against a 14 amino acid peptide near the center of human ENC-2.
KLHL25 Rabbit Polyclonal Antibody
TA337249

USD 310.00

5 Days

Rabbit Polyclonal Anti-KLHL25 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: RLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFE
KLHL25 Rabbit Polyclonal Antibody
TA335481

USD 375.00

5 Days

Rabbit Polyclonal Anti-KLHL25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KLHL25 Antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: SRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENA
KLHL25 Rabbit Polyclonal Antibody
TA337996

USD 375.00

5 Days

Rabbit Polyclonal Anti-KLHL25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: LFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTL