Rabbit Polyclonal Anti-NMUR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NMUR2 antibody: synthetic peptide directed towards the N terminal of human NMUR2. Synthetic peptide located within the following region: MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV |
Rabbit Polyclonal Anti-NMUR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NMUR2 antibody: synthetic peptide directed towards the N terminal of human NMUR2. Synthetic peptide located within the following region: MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV |
NMUR2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 326-415 of human NMUR2 (NP_064552.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China