Antibodies

Jump to Filters
View as table Download
Slc8a3 Rabbit Polyclonal Antibody
TA328917

USD 585.00

3 Weeks

Rabbit polyclonal Anti-Na+/Ca2+ Exchanger 3 (NCX-3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)PLEGKEVDESRRE, corresponding to amino acid residues 303- 315 of rat NCX-3 . 3rd intracellular loop
SLC8A3 Rabbit Polyclonal Antibody
TA333587

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC8A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC8A3 Antibody: synthetic peptide directed towards the N terminal of human SLC8A3. Synthetic peptide located within the following region: SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE
SLC8A3 Rabbit Polyclonal Antibody
TA323836

USD 345.00

In Stock

Anti-SLC8A3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 33-47 amino acids of Human solute carrier family 8 (sodium/calcium exchanger), member 3
SLC8A3 Rabbit Polyclonal Antibody
TA323837

USD 345.00

In Stock

Anti-SLC8A3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 33-47 amino acids of Human solute carrier family 8 (sodium/calcium exchanger), member 3
SLC8A3 Rabbit Polyclonal Antibody
TA351712

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLC8A3 Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC8A3
SLC8A3 Rabbit Polyclonal Antibody
TA367271

USD 380.00

4 Weeks

SLC8A3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC8A3