Antibodies

Jump to Filters
View as table Download
UNC93B (UNC93B1) Rabbit Polyclonal Antibody
TA306557

USD 430.00

2 Weeks

Rabbit Polyclonal Unc93b Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Unc93b antibody was raised against a 19 amino acid peptide from near the amino terminus of human Unc93b.
UNC93B (UNC93B1) Rabbit Polyclonal Antibody
TA339570

USD 310.00

5 Days

Rabbit Polyclonal Anti-UNC93B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC93B1 antibody: synthetic peptide directed towards the N terminal of human UNC93B1. Synthetic peptide located within the following region: LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK
UNC93B (UNC93B1) Rabbit Polyclonal Antibody
TA337051

USD 424.00

5 Days

Rabbit Polyclonal UNC93B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acid 500-550 of mouse UNC93B protein was used as the immunogen.
UNC93B1 Rabbit Polyclonal Antibody
TA367837

USD 380.00

4 Weeks

UNC93B1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UNC93B1
UNC93B (UNC93B1) Rabbit Polyclonal Antibody
TA383107

USD 220.00

3 Weeks

UNC93B1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human UNC93B1 (NP_112192.2).
Modifications Unmodified