Antibodies

View as table Download

Rabbit Polyclonal Anti-ZCCHC7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZCCHC7 antibody: synthetic peptide directed towards the C terminal of human ZCCHC7. Synthetic peptide located within the following region: KNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQKPSKPFHRSSHYH

ZCCHC7 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZCHC7