Antibodies

Jump to Filters
View as table Download
CHST11 Rabbit Polyclonal Antibody
TA342375

USD 375.00

5 Days

Rabbit Polyclonal Anti-Chst11 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Chst11 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Chst11. Synthetic peptide located within the following region: RMVLATCFGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYN
CHST11 Rabbit Polyclonal Antibody
TA365646

USD 380.00

4 Weeks

CHST11 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CHST11
CHST11 Rabbit Polyclonal Antibody
TA369978

USD 380.00

4 Weeks

CHST11 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CHST11