Antibodies

Jump to Filters
View as table Download
LRRFIP1 Rabbit Polyclonal Antibody
TA339099

USD 375.00

5 Days

Rabbit Polyclonal Anti-Lrrfip1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Lrrfip1 antibody is: synthetic peptide directed towards the middle region of Mouse Lrrfip1. Synthetic peptide located within the following region: IREIKELNELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQLD
Lrrfip1 Rabbit Polyclonal Antibody
TA356880

USD 360.00

5 Days

Lrrfip1 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated