Rabbit polyclonal anti-PRIM1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human PRIM1. |
Rabbit polyclonal anti-PRIM1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human PRIM1. |
Rabbit Polyclonal Anti-Prim1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Prim1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EKEKEENEADSKHRVRGYKKTSLAPYVKVFEQFLENLDKSRKGELLKKSD |
PRIM1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 121-420 of human PRIM1 (NP_000937.1). |