Antibodies

Jump to Filters
View as table Download
Sgms1 Rabbit Polyclonal Antibody
TA329766

USD 375.00

5 Days

Rabbit polyclonal Anti-Sgms1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Sgms1 antibody is: synthetic peptide directed towards the middle region of Mouse Sgms1. Synthetic peptide located within the following region: LTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMILVGL