Goat Polyclonal Antibody against SIM1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SGDRYRTEQYQS, from the internal region of the protein sequence according to NP_005059.2. |
Goat Polyclonal Antibody against SIM1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SGDRYRTEQYQS, from the internal region of the protein sequence according to NP_005059.2. |
Rabbit Polyclonal Anti-SIM1 Antibody
Applications | IHC |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SIM1 Antibody is: synthetic peptide directed towards the middle region of Human SIM1. Synthetic peptide located within the following region: SSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLLDPADR |