Antibodies

Jump to Filters
View as table Download
TCN2 Rabbit Polyclonal Antibody
TA332889

USD 275.00

3 Weeks

Rabbit anti-TCN2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human TCN2
Tcn2 Rabbit Polyclonal Antibody
TA346535

USD 475.00

5 Days

Rabbit Polyclonal Anti-Tcn2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Tcn2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS