Antibodies

Jump to Filters
View as table Download
Atat1 Rabbit Polyclonal Antibody
TA329481

USD 375.00

5 Days

Rabbit Polyclonal anti-Atat1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Atat1 antibody is: synthetic peptide directed towards the middle region of Rat Atat1. Synthetic peptide located within the following region: WPLNRAPRRATPPAHPPPRSSSLGNSPDRGPLRPFVPEQELLRSLRLCPP
ATAT1 Rabbit Polyclonal Antibody
TA366720

USD 380.00

4 Weeks

ATAT1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ATAT1