Antibodies

Jump to Filters
View as table Download
KCNG4 Rabbit Polyclonal Antibody
TA338761

USD 375.00

5 Days

Rabbit Polyclonal Anti-Kcng4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Kcng4 antibody is: synthetic peptide directed towards the middle region of RAT Kcng4. Synthetic peptide located within the following region: SDESPEAGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGL
KCNG4 Rabbit Polyclonal Antibody
TA377707

USD 220.00

3 Weeks

KCNG4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human KCNG4 (NP_758857.1).
Modifications Unmodified