Antibodies

View as table Download

Rabbit Polyclonal Anti-Cpne7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cpne7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPKVQLYGPTNV

Rabbit Polyclonal Anti-Cpne7 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cpne7 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GDDGILRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEY

CPNE7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPNE7

CPNE7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPNE7