Rabbit Polyclonal Anti-ESD Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ESD antibody: synthetic peptide directed towards the N terminal of human ESD. Synthetic peptide located within the following region: MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW |
Rabbit polyclonal anti-ESD antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This ESD antibody is generated from a rabbit immunized with a KLH conjugated synthetic peptide between 68-102 amino acids from the Central region of human ESD. |
ESD Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-282 of human ESD (NP_001975.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China