Antibodies

View as table Download

OR2W3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 293-314 amino acids from the C-terminal region of human Olfactory receptor 2W3

Rabbit polyclonal anti-OR2W3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2W3.

Rabbit Polyclonal Anti-OR2W3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2W3 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2W3. Synthetic peptide located within the following region: IIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGALGRL