Antibodies

View as table Download

PDE4 (PDE4B) (723-736) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide from C-terminus of Human PDE4B

PDE4 (PDE4B) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 196-225 amino acids from the Central region of Human PDE4B

Rabbit Polyclonal Anti-PDE4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE4B Antibody: synthetic peptide directed towards the middle region of human PDE4B. Synthetic peptide located within the following region: QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED

Goat Polyclonal Antibody against Phosphodiesterase 4B

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-DIDIATEDKSPVDT, from the C Terminus of the protein sequence according to NP_002591.2; NP_001032418.1; NP_001032416.1; NP_001032417.1.

Rabbit polyclonal antibody to Phosphodiesterase 4B (phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 489 and 736 of PDE4B (Uniprot ID#Q07343)

Pde4b Antibody - N-terminal region

Applications WB
Reactivities Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse